Cusabio Mouse Recombinants
Recombinant Mouse Diazepam-binding inhibitor-like 5 (Dbil5) | CSB-EP520959MO
- SKU:
- CSB-EP520959MO
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mouse Diazepam-binding inhibitor-like 5 (Dbil5) | CSB-EP520959MO | Cusabio
Alternative Name(s): Endozepine-like peptide
Gene Names: Dbil5
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-87aa
Sequence Info: Full Length
MW: 13.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: May be involved in the energy metabolism of the mature sperm.
Reference: "Progressive inactivation of the haploid expressed gene for the sperm-specific endozepine-like peptide (ELP) through primate evolution." Ivell R., Pusch W., Balvers M., Valentin M., Walther N., Weinbauer G. Gene 255:335-345(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May be involved in the energy metabolism of the mature sperm.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: ACBP family
Tissue Specificity: Exclusively expressed in late spermatids and spermatozoa. Not found in epididymis, spleen, bone marrow, skin, liver, brain, heart, kidney, muscle.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O09035
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A