Recombinant Mouse Diazepam-binding inhibitor-like 5 (Dbil5) | CSB-EP520959MO

Recombinant Mouse Diazepam-binding inhibitor-like 5 (Dbil5) | CSB-EP520959MO | Cusabio

Alternative Name(s): Endozepine-like peptide

Gene Names: Dbil5

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-87aa

Sequence Info: Full Length

MW: 13.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in the energy metabolism of the mature sperm.

Reference: "Progressive inactivation of the haploid expressed gene for the sperm-specific endozepine-like peptide (ELP) through primate evolution." Ivell R., Pusch W., Balvers M., Valentin M., Walther N., Weinbauer G. Gene 255:335-345(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in the energy metabolism of the mature sperm.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: ACBP family

Tissue Specificity: Exclusively expressed in late spermatids and spermatozoa. Not found in epididymis, spleen, bone marrow, skin, liver, brain, heart, kidney, muscle.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O09035

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A