Recombinant Mouse D-dopachrome decarboxylase (Ddt) | CSB-EP006598MO

(No reviews yet) Write a Review
SKU:
CSB-EP006598MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse D-dopachrome decarboxylase (Ddt)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse D-dopachrome decarboxylase (Ddt) | CSB-EP006598MO | Cusabio

Alternative Name(s): D-dopachrome tautomerase

Gene Names: Ddt

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: PFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPGMTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLEAWQIGKKGTVMTFL

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-118aa

Sequence Info: Full Length of Mature Protein

MW: 16.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).

Reference: SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: MIF family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O35215

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose