Recombinant Mouse Cysteine sulfinic acid decarboxylase (Csad) | CSB-EP006032MO

(No reviews yet) Write a Review
SKU:
CSB-EP006032MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Cysteine sulfinic acid decarboxylase (Csad)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Mouse Cysteine sulfinic acid decarboxylase (Csad) | CSB-EP006032MO | Cusabio

Alternative Name(s): Cysteine-sulfinate decarboxylase;Sulfinoalanine decarboxylase

Gene Names: Csad

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: MADSKPLRTLDGDPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-493aa

Sequence Info: Full Length

MW: 71.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Group II decarboxylase family

Tissue Specificity: Expressed in kidney and liver not detected in lymphoid tissues and lung.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9DBE0

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose