Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) | CSB-MP875360MO

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) | CSB-MP875360MO | Cusabio

Alternative Name(s): Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3

Gene Names: C1qtnf3

Research Areas: Metabolism

Organism: Mus musculus (Mouse)

AA Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged

Expression Region: 23-246aa

Sequence Info: Full Length of Mature Protein

MW: 26.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Role of specificity protein-1, PPARgamma, and pituitary protein transcription factor-1 in transcriptional regulation of the murine CORS-26 promoter." Schaffler A., Ehling A., Neumann E., Herfarth H., Paul G., Tarner I., Gay S., Buechler C., Scholmerich J., Muller-Ladner U. Biochim. Biophys. Acta 1678:150-156(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9ES30

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A