Recombinant Mouse Complement C1q-like protein 3 (C1ql3) | CSB-BP863674MOb1

(No reviews yet) Write a Review
SKU:
CSB-BP863674MOb1
Availability:
3 - 7 Working Days
$531.60 - $1,272.00

Description

Recombinant Mouse Complement C1q-like protein 3 (C1ql3) | CSB-BP863674MOb1 | Cusabio

Alternative Name(s): C1q and tumor necrosis factor-related protein 13 (C1q/TNF-related protein 13) (CTRP13) (Gliacolin) (C1ql) (Ctrp13)

Gene Names: C1ql3

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: HYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 21-255aa

Sequence Info: Full Length of Mature Protein

MW: 28.6

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production.

Reference: "Molecular cloning of a new mouse C1q-like gene expressed in glia." Watanabe Y., Yorihuzi T., Yamazaki Y., Kubota H., Hosokawa N., Nagata K. Submitted (JUL-2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9ESN4

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose