Recombinant Mouse Chemokine-like protein TAFA-1 (Tafa1) | CSB-EP763174MO

(No reviews yet) Write a Review
SKU:
CSB-EP763174MO
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Mouse Chemokine-like protein TAFA-1 (Tafa1) | CSB-EP763174MO | Cusabio

Alternative Name(s): Fam19a1

Gene Names: Tafa1

Research Areas: Epigenetics and Nuclear Signaling

Organism: Mus musculus(Mouse)

AA Sequence: MLLCHGSLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 20-133aa

Sequence Info: Full Length of Mature Protein

MW: 20.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Regulatory factor which is ligand for GPR1 and is involved in the modulation of neural stem-cell proliferation and differentiation.

Reference: "FAM19A1 is a new ligand for GPR1 that modulates neural stem-cell proliferation and differentiation." Zheng C., Chen D., Zhang Y., Bai Y., Huang S., Zheng D., Liang W., She S., Peng X., Wang P., Mo X., Song Q., Lv P., Huang J., Ye R.D., Wang Y. FASEB J. 0:0-0(2018)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q7TPG8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose