Recombinant Mouse Cerebellin-3 (Cbln3) | CSB-CF881291MO

Recombinant Mouse Cerebellin-3 (Cbln3) | CSB-CF881291MO | Cusabio

Alternative Name(s): Cbln3Cerebellin-3

Gene Names: Cbln3

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-197aa

Sequence Info: Full Length of Mature Protein

MW: 22.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in synaptic functions in the CNS.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in synaptic functions in the CNS.

Involvement in disease:

Subcellular Location: Endoplasmic reticulum, Golgi apparatus, cis-Golgi network, Secreted, Cell junction, synapse

Protein Families:

Tissue Specificity: Expressed in brain, restricted to the cerebellar cortex. Within the cerebellum, expressed in granule layers (at protein level). Also detected in postsynaptic Purkinje cell spines (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9JHG0

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A