Recombinant Mouse CD81 antigen (Cd81), partial | CSB-EP004960MO

Recombinant Mouse CD81 antigen (Cd81), partial | CSB-EP004960MO | Cusabio

Alternative Name(s): 26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1; CD81

Gene Names: Cd81

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 116-201aa

Sequence Info: Partial

MW: 36.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.

Reference: Possible involvement of CD81 in acrosome reaction of sperm in mice.Tanigawa M., Miyamoto K., Kobayashi S., Sato M., Akutsu H., Okabe M., Mekada E., Sakakibara K., Miyado M., Umezawa A., Miyado K.Mol. Reprod. Dev. 75:150-155(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.

Involvement in disease:

Subcellular Location: Basolateral cell membrane, Multi-pass membrane protein

Protein Families: Tetraspanin (TM4SF) family

Tissue Specificity: Expressed in oocytes. Highly expressed in granulosa cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P35762

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A