Recombinant Mouse CCN family member 5 (Ccn5) | CSB-YP896674MO

(No reviews yet) Write a Review
SKU:
CSB-YP896674MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse CCN family member 5 (Ccn5)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,135.00

Description

Recombinant Mouse CCN family member 5 (Ccn5) | CSB-YP896674MO | Cusabio

Alternative Name(s): CCN family member 5 Connective tissue growth factor-like protein Short name: CTGF-L

Gene Names: Ccn5

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-251aa

Sequence Info: Full Length of Mature Protein

MW: 26.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).

Reference: "Identification and cloning of a connective tissue growth factor-like cDNA from human osteoblasts encoding a novel regulator of osteoblast functions."Kumar S., Hand A.T., Connor J.R., Dodds R.A., Ryan P.J., Trill J.J., Fisher S.M., Nuttall M.E., Lipshutz D.B., Zou C., Hwang S.M., Votta B.J., James I.E., Rieman D.J., Gowen M., Lee J.C.J. Biol. Chem. 274:17123-17131(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: CCN family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9Z0G4

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose