Recombinant Mouse Caspase-12 (Casp12), partial | CSB-EP004545MO

(No reviews yet) Write a Review
SKU:
CSB-EP004545MO
Availability:
13 - 23 Working Days
$422.40 - $2,042.40

Description

Recombinant Mouse Caspase-12 (Casp12), partial | CSB-EP004545MO | Cusabio

Alternative Name(s): Caspase-12(CASP-12)(EC 3.4.22.-)

Gene Names: Casp12

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDE

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 1-92aa

Sequence Info: Partial

MW: 24.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in the activation cascade of caspases responsible for apoptosis execution.

Reference: "Activation of caspase-12, an endoplastic reticulum (ER) resident caspase, through tumor necrosis factor receptor-associated factor 2-dependent mechanism in response to the ER stress." Yoneda T., Imaizumi K., Oono K., Yui D., Gomi F., Katayama T., Tohyama M. J. Biol. Chem. 276:13935-13940(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O08736

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose