Recombinant Mouse Carbonic anhydrase 14 (Ca14), partial (Active) | CSB-AP005781MO

Recombinant Mouse Carbonic anhydrase 14 (Ca14) ,partial (Active) | CSB-AP005781MO | Cusabio

Protein Description: Partial

Alternative Name (s) : Carbonic Anhydrase 14; Carbonate Dehydratase XIV; Carbonic Anhydrase XIV; CA-XIV; CA14;

Gene Names: Ca14

Research Areas: Neuroscience

Species: Mus musculus (Mouse)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 16-290aa

Sequence Info: ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

Biological Activity: The esterase activity is determined to be greater than 400 pmol/min/µg.

MW: 31.8 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Mouse Ca14,also known as Carbonic anhydrase 14,is a member of large family of zinc metalloenzymes .It could catalyze reversible hydration of carbon dioxide. The reaction is fundamental to many processes such as respiration, renal tubular acidification and bone resorption. Fifteen CA isoforms have been reported so far. They have different patterns of tissue-specific expression and physiologic roles. Some CAs may serve as markers for tumors and hypoxia. CA XIV is a polypeptide consisting of an extracellular N-terminal catalytic domain, a membrane-spanning segment and a short intracellular C- terminal segment with several potential phosphorylation sites. A subset of CAs lack CA activity due to point mutations but retain esterase function. CA14 is widely expressed in the central nervous system

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Reversible hydration of carbon dioxide.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type I membrane protein

Protein Families: Alpha-carbonic anhydrase family

Tissue Specificity: Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver.

Paythway:

Form: Liquid

Buffer: 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0

Reconstitution:

Uniprot ID: Q9WVT6

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A