Recombinant Mouse Calcium-dependent phospholipase A2 (Pla2g5) | CSB-EP018103MO

(No reviews yet) Write a Review
SKU:
CSB-EP018103MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Calcium-dependent phospholipase A2 (Pla2g5)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Calcium-dependent phospholipase A2 (Pla2g5) | CSB-EP018103MO | Cusabio

Alternative Name(s): Group V phospholipase A2;PLA2-10Phosphatidylcholine 2-acylhydrolase 5

Gene Names: Pla2g5

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-137aa

Sequence Info: Full Length of Mature Protein

MW: 29.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol .

Reference: Low-molecular-weight, calcium-dependent phospholipase A2 genes are linked and map to homologous chromosome regions in mouse and human.Tischfield J.A., Xia Y.R., Shih D.M., Klisak I., Chen J., Engle S.J., Siakotos A.N., Winstead M.V., Seilhamer J.J., Allamand V., Gyapay G., Lusis A.Genomics 32:328-333(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol (By similarity).

Involvement in disease:

Subcellular Location: Secreted, Membrane

Protein Families: Phospholipase A2 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P97391

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose