Recombinant Mouse Cadherin-17 (Cdh17), partial | CSB-EP882608MO

Recombinant Mouse Cadherin-17 (Cdh17), partial | CSB-EP882608MO | Cusabio

Alternative Name(s): BILL-cadherin (Liver-intestine cadherin) (LI-cadherin) (P130)

Gene Names: Cdh17

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: INDVMYFQIDSKTGAISLTPEGSQELDPVKNPSYNLVVSVKDMGGQSENSFSDTTYVDISIRENIWKAPEPVEIRENSTDP

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 173-253aa

Sequence Info: Partial

MW: 13.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. LI-cadherin may have a role in the morphological organization of liver and intestine.

Reference: "Mechanisms involved in vitamin D mediated intestinal calcium absorption and in non-classical actions of vitamin D." Christakos S., Dhawan P., Ajibade D., Benn B.S., Feng J., Joshi S.S. J. Steroid Biochem. Mol. Biol. 121:183-187(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9R100

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A