Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3) | CSB-RP092394m

Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3) | CSB-RP092394m | Cusabio

Alternative Name(s): Dendritic cell inflammatory protein 11

Gene Names: Cxcl3

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: SELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 32-100aa

Sequence Info: Full Length of Mature Protein

MW: 11.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ligand for CXCR2. Has chotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Reference: IL-10-conditioned dendritic cells, decommissioned for recruitment of adaptive immunity, elicit innate inflammatory gene products in response to danger signals.Nolan K.F., Strong V., Soler D., Fairchild P.J., Cobbold S.P., Croxton R., Gonzalo J.-A., Rubio A., Wells M., Waldmann H.J. Immunol. 172:2201-2209(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6W5C0

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A