Recombinant Mouse C-X-C motif chemokine 11 (Scyb11), partial | CSB-RP092874m

(No reviews yet) Write a Review
SKU:
CSB-RP092874m
Availability:
13 - 23 Working Days
  • Recombinant Mouse C-X-C motif chemokine 11 (Scyb11), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse C-X-C motif chemokine 11 (Scyb11), partial | CSB-RP092874m | Cusabio

Alternative Name(s): Interferon-inducible T-cell alpha chemoattractant ;I-TACSmall-inducible cytokine B11

Gene Names: Scyb11

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-98aa

Sequence Info: Partial

MW: 12.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Chotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses .

Reference: The murine chemokine CXCL11 (IFN-inducible T cell alpha chemoattractant) is an IFN-gamma- and lipopolysaccharide-inducible glucocorticoid-attenuated response gene expressed in lung and other tissues during endotoxemia.Widney D.P., Xia Y.-R., Lusis A.J., Smith J.B.J. Immunol. 164:6322-6331(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9JHH5

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose