Recombinant Mouse C-X-C chemokine receptor type 3 (Cxcr3), partial | CSB-EP006253MO1

Recombinant Mouse C-X-C chemokine receptor type 3 (Cxcr3), partial | CSB-EP006253MO1 | Cusabio

Alternative Name(s): Interferon-inducible protein 10 receptor (IP-10 receptor) (CD_antigen: CD183) (CXC-R3) (CXCR-3) (Cmkar3)

Gene Names: Cxcr3

Research Areas: Cardiovascular

Organism: Mus musculus(Mouse)

AA Sequence: MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR

Source: E.coli

Tag Info: N-terminal 6xHis-KSI-tagged

Expression Region: 1-52aa

Sequence Info: Partial

MW: 21.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response.

Reference: "Cloning of the murine interferon-inducible protein 10 (IP-10) receptor and its specific expression in lymphoid organs." Tamaru M., Tominaga Y., Yatunami K., Narumi S. Biochem. Biophys. Res. Commun. 251:41-48(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O88410

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A