Recombinant Mouse C-C motif chemokine 4 (Ccl4) | CSB-EP004797MO

(No reviews yet) Write a Review
SKU:
CSB-EP004797MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse C-C motif chemokine 4 (Ccl4)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse C-C motif chemokine 4 (Ccl4) | CSB-EP004797MO | Cusabio

Alternative Name(s): Immune activation protein 2 ;ACT-2 ;ACT2Macrophage inflammatory protein 1-beta ;MIP-1-betaProtein H400SIS-gamma;Small-inducible cytokine A4

Gene Names: Ccl4

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-92aa

Sequence Info: Full Length of Mature Protein

MW: 11.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Monokine with inflammatory and chokinetic properties.

Reference: Resolution of the two components of macrophage inflammatory protein 1, and cloning and characterization of one of those components, macrophage inflammatory protein 1 beta.Sherry B., Tekamp-Olson P., Gallegos C., Bauer D., Davatelis G., Wolpe S.D., Masiarz F., Coit D., Cerami A.J. Exp. Med. 168:2251-2259(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Monokine with inflammatory and chemokinetic properties.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine beta (chemokine CC) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P14097

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose