Cusabio Mouse Recombinants
Recombinant Mouse C-C motif chemokine 4 (Ccl4) | CSB-EP004797MO
- SKU:
- CSB-EP004797MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse C-C motif chemokine 4 (Ccl4) | CSB-EP004797MO | Cusabio
Alternative Name(s): Immune activation protein 2 ;ACT-2 ;ACT2Macrophage inflammatory protein 1-beta ;MIP-1-betaProtein H400SIS-gamma;Small-inducible cytokine A4
Gene Names: Ccl4
Research Areas: Immunology
Organism: Mus musculus (Mouse)
AA Sequence: APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 24-92aa
Sequence Info: Full Length of Mature Protein
MW: 11.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Monokine with inflammatory and chokinetic properties.
Reference: Resolution of the two components of macrophage inflammatory protein 1, and cloning and characterization of one of those components, macrophage inflammatory protein 1 beta.Sherry B., Tekamp-Olson P., Gallegos C., Bauer D., Davatelis G., Wolpe S.D., Masiarz F., Coit D., Cerami A.J. Exp. Med. 168:2251-2259(1988)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Monokine with inflammatory and chemokinetic properties.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Intercrine beta (chemokine CC) family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P14097
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A