Recombinant Mouse Beta-synuclein (Sncb) | CSB-EP838720MO

(No reviews yet) Write a Review
SKU:
CSB-EP838720MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Beta-synuclein (Sncb)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$487.20 - $2,172.00

Description

Recombinant Mouse Beta-synuclein (Sncb) | CSB-EP838720MO | Cusabio

Alternative Name(s): Sncb; Beta-synuclein

Gene Names: Sncb

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA

Source: E.coli

Tag Info: Tag-Free

Expression Region: 1-133aa

Sequence Info: Full Length

MW: 14.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May be involved in neuronal plasticity.

Reference: "Genomic organization, chromosome location, and expression analysis of mouse beta-synuclein, a candidate for involvement in neurodegeneration." Sopher B.L., Koszdin K.L., McClain M.E., Myrick S.B., Martinez R.A., Smith A.C., La Spada A.R. Cytogenet. Cell Genet. 93:117-123(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in neuronal plasticity.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Synuclein family

Tissue Specificity: Highly expressed in the brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q91ZZ3

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose