Cusabio Mouse Recombinants
Recombinant Mouse Beta-synuclein (Sncb) | CSB-EP838720MO
- SKU:
- CSB-EP838720MO
- Availability:
- 13 - 23 Working Days
Description
Recombinant Mouse Beta-synuclein (Sncb) | CSB-EP838720MO | Cusabio
Alternative Name(s): Sncb; Beta-synuclein
Gene Names: Sncb
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTSGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEA
Source: E.coli
Tag Info: Tag-Free
Expression Region: 1-133aa
Sequence Info: Full Length
MW: 14.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: May be involved in neuronal plasticity.
Reference: "Genomic organization, chromosome location, and expression analysis of mouse beta-synuclein, a candidate for involvement in neurodegeneration." Sopher B.L., Koszdin K.L., McClain M.E., Myrick S.B., Martinez R.A., Smith A.C., La Spada A.R. Cytogenet. Cell Genet. 93:117-123(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May be involved in neuronal plasticity.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Synuclein family
Tissue Specificity: Highly expressed in the brain.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q91ZZ3
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A