Recombinant Mouse Beta-defensin 4 (Defb4) | CSB-EP305482MO

(No reviews yet) Write a Review
SKU:
CSB-EP305482MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Beta-defensin 4 (Defb4)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Beta-defensin 4 (Defb4) | CSB-EP305482MO | Cusabio

Alternative Name(s): Defensin, beta 4

Gene Names: Defb4

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: QIINNPITCMTNGAICWGPCPTAFRQIGNCGHFKVRCCKIR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 23-63aa

Sequence Info: Full Length of Mature Protein

MW: 20.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has bactericidal activity

Reference: "A novel murine beta-defensin expressed in tongue, esophagus, and trachea."Jia H.P., Wowk S.A., Schutte B.C., Lee S.K., Vivado A., Tack B.F., Bevins C.L., McCray P.B. Jr.J. Biol. Chem. 275:33314-33320(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to mouse (but not human) CCR6 and induce chemotactic activity of CCR6-expressing cells

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Beta-defensin family

Tissue Specificity: Tongue, esophagus and trachea.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P82019

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose