Recombinant Mouse Beta-defensin 1 (Defb1) | CSB-EP006662MO

Recombinant Mouse Beta-defensin 1 (Defb1) | CSB-EP006662MO | Cusabio

Alternative Name(s): Short name:BD-1 Short name:mBD-1

Gene Names: Defb1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 33-69aa

Sequence Info: Full Length of Mature Protein

MW: 20.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has bactericidal activity.

Reference: "The mouse genome encodes a single homolog of the antimicrobial peptide human beta-defensin 1."Huttner K.M., Kozak C.A., Bevins C.L.FEBS Lett. 413:45-49(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.

Involvement in disease:

Subcellular Location: Secreted, Membrane

Protein Families: Beta-defensin family

Tissue Specificity: Detected in kidney.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P56386

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A