Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) , partial | CSB-EP015007MO2

(No reviews yet) Write a Review
SKU:
CSB-EP015007MO2
Availability:
13 - 23 Working Days
  • Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) , partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1) , partial | CSB-EP015007MO2 | Cusabio

Alternative Name(s): B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20

Gene Names: Ms4a1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 132-291aa

Sequence Info: Partial

MW: 34.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This protein may be involved in the regulation of B-cell activation and proliferation.

Reference: CD20 deficiency in humans results in impaired T cell-independent antibody responses.Kuijpers T.W., Bende R.J., Baars P.A., Grummels A., Derks I.A.M., Dolman K.M., Beaumont T., Tedder T.F., van Noesel C.J.M., Eldering E., van Lier R.A.W.J. Clin. Invest. 120:214-222(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This protein may be involved in the regulation of B-cell activation and proliferation.

Involvement in disease:

Subcellular Location: Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor

Protein Families: MS4A family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19437

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose