Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial | CSB-EP002207MO

(No reviews yet) Write a Review
SKU:
CSB-EP002207MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial | CSB-EP002207MO | Cusabio

Alternative Name(s): Hepatic lectin 1 ;HL-1 ;mHL-1

Gene Names: Asgr1

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 61-284aa

Sequence Info: Extracellular Domain

MW: 52.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been roved. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell mbrane surface.

Reference: Determination of mouse major asialoglycoprotein receptor cDNA sequence.Takezawa R., Shinzawa K., Watanabe Y., Akaike T.Biochim. Biophys. Acta 1172:220-222(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein

Protein Families:

Tissue Specificity: Expressed exclusively in hepatic parenchymal cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P34927

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose