Cusabio Mouse Recombinants
Recombinant Mouse Aquaporin-4 (Aqp4), partial | CSB-YP001964MO1f3
- SKU:
- CSB-YP001964MO1f3
- Availability:
- 25 - 35 Working Days
Description
Recombinant Mouse Aquaporin-4 (Aqp4), partial | CSB-YP001964MO1f3 | Cusabio
Alternative Name(s): Mercurial-insensitive water channel
Gene Names: Aqp4
Research Areas: Others
Organism: Mus musculus (Mouse)
AA Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV
Source: Yeast
Tag Info: C-terminal 6xHis-Myc-tagged
Expression Region: 253-323aa
Sequence Info: Partial
MW: 10.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Reference: "Role of aquaporin-4 in airspace-to-capillary water permeability in intact mouse lung measured by a novel gravimetric method." Song Y., Ma T., Matthay M.A., Verkman A.S. J. Gen. Physiol. 115:17-27(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Involvement in disease:
Subcellular Location: Membrane, Multi-pass membrane protein
Protein Families: MIP/aquaporin (TC 1.A.8) family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P55088
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A