Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial | CSB-EP002611MO

Recombinant Mouse Apoptosis regulator Bcl-2 (Bcl2), partial | CSB-EP002611MO | Cusabio

Alternative Name(s): Bcl2; Bcl-2; Apoptosis regulator Bcl-2

Gene Names: Bcl2

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 5-205aa

Sequence Info: Partial

MW: 26.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Suppresses apoptosis in a variety of cell systs including factor-dependent lymphohatopoietic and neural cells. Regulates cell death by controlling the mitochondrial mbrane permeability. Appears to function in a feedback loop syst with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).

Reference: Apoptosis factor EI24/PIG8 is a novel endoplasmic reticulum-localized Bcl-2-binding protein which is associated with suppression of breast cancer invasiveness.Zhao X., Ayer R.E., Davis S.L., Ames S.J., Florence B., Torchinsky C., Liou J.S., Shen L., Spanjaard R.A.Cancer Res. 65:2125-2129(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release

Involvement in disease:

Subcellular Location: Mitochondrion outer membrane, Single-pass membrane protein, Nucleus membrane, Single-pass membrane protein, Endoplasmic reticulum membrane, Single-pass membrane protein

Protein Families: Bcl-2 family

Tissue Specificity: Expressed in a variety of tissues.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10417

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A