null

Recombinant Mouse Angiogenin-4 (Ang4) | CSB-YP661010MOa4

(No reviews yet) Write a Review
SKU:
CSB-YP661010MOa4
Availability:
3 - 7 Working Days
  • Recombinant Mouse Angiogenin-4 (Ang4)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,135.00
Frequently bought together:

Description

Recombinant Mouse Angiogenin-4 (Ang4) | CSB-YP661010MOa4 | Cusabio

Alternative Name(s): Ang4Angiogenin-4; EC 3.1.27.-

Gene Names: Ang4

Research Areas: Cardiovascular

Organism: Mus musculus (Mouse)

AA Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

Expression Region: 25-144aa

Sequence Info: Full Length of Mature Protein

MW: 29.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro)

Reference: "Angiogenins: a new class of microbicidal proteins involved in innate immunity." Hooper L.V., Stappenbeck T.S., Hong C.V., Gordon J.I. Nat. Immunol. 4:269-273(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).

Involvement in disease:

Subcellular Location: Cytoplasmic vesicle, secretory vesicle lumen, Secreted, Nucleus, nucleolus

Protein Families: Pancreatic ribonuclease family

Tissue Specificity: Detected in small intestine, caecum and colon, with the highest expression in Paneth cells in the intestinal epithelium.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q3TMQ6

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose