Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), partial | CSB-EP745079MO

(No reviews yet) Write a Review
SKU:
CSB-EP745079MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), partial
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP745079MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Adamts13.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP745079MO could indicate that this peptide derived from E.coli-expressed
£281.60 - £1,361.60

Description

Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), partial | CSB-EP745079MO | Cusabio

Alternative Name(s): von Willebrand factor-cleaving protease (vWF-CP) (vWF-cleaving protease) (ADAM-TS 13) (ADAM-TS13) (ADAMTS-13) (Gm710)

Gene Names: Adamts13

Research Areas: Cancer

Organism: Mus musculus (Mouse)

AA Sequence: WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 904-1137aa

Sequence Info: Partial

MW: 32.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.

Reference: "The combined roles of ADAMTS13 and VWF in murine models of TTP, endotoxemia, and thrombosis." Chauhan A.K., Walsh M.T., Zhu G., Ginsburg D., Wagner D.D., Motto D.G. Blood 111:3452-3457(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Plasma. Expression is consistently high in liver, medium in lung and spleen, low in skeletal muscle and undetectable in heart, brain, kidney and testis.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q769J6

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose