Recombinant Mouse 3-hydroxy-3-methylglutaryl-coenzyme A reductase (Hmgcr), partial | CSB-EP010565MO1

(No reviews yet) Write a Review
SKU:
CSB-EP010565MO1
Availability:
3 - 7 Working Days
  • Recombinant Mouse 3-hydroxy-3-methylglutaryl-coenzyme A reductase (Hmgcr), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Mouse 3-hydroxy-3-methylglutaryl-coenzyme A reductase (Hmgcr), partial | CSB-EP010565MO1 | Cusabio

Alternative Name(s): Hmgcr; 3-hydroxy-3-methylglutaryl-coenzyme A reductase; HMG-CoA reductase; EC 1.1.1.34

Gene Names: Hmgcr

Research Areas: Cardiovascular

Organism: Mus musculus (Mouse)

AA Sequence: GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGH

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 700-860aa

Sequence Info: Partial

MW: 20.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.

Reference: "Glucocorticoid-regulated gene expression in the immune system. Analysis of glucocorticoid-regulated transcripts from the mouse macrophage-like cell line P388D1." Helmberg A., Faessler R., Geley S., Joehrer K., Kroemer G., Boeck G., Kofler R. J. Immunol. 145:4332-4337(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.

Involvement in disease:

Subcellular Location: Endoplasmic reticulum membrane, Multi-pass membrane protein

Protein Families: HMG-CoA reductase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q01237

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose