Recombinant Moraxella bovis Fimbrial protein 1 | CSB-YP322675MHZ

(No reviews yet) Write a Review
SKU:
CSB-YP322675MHZ
Availability:
25 - 35 Working Days
  • Recombinant Moraxella bovis Fimbrial protein 1
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP322675MHZ could indicate that this peptide derived from Yeast-expressed Moraxella bovis N/A.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP322675MHZ could indicate that this peptide derived from Yeast-expressed
$459.60 - $1,614.00

Description

Recombinant Moraxella bovis Fimbrial protein 1 | CSB-YP322675MHZ | Cusabio

Alternative Name(s): Alpha-pilin (Fimbrial protein I) (I pilin)

Gene Names: N/A

Research Areas: Others

Organism: Moraxella bovis

AA Sequence: FTLIELMIVIAIIGILAAIALPAYQDYISKSQTTRVSGELAAGKTAVDAALFEGKTPVLSEESSTSKENIGLTSSETSTKPRSNLMASVELTGFADNGAGTISATLGNKANKDIAKTVITQERTTDGVWTCKIDGSQAAKYKEKFNPTGCVKK

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

Expression Region: 7-159aa

Sequence Info: Full Length of Mature Protein

MW: 29.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Purification, characterization, and pathogenicity of Moraxella bovis pili." Ruehl W.W., Marrs C.F., Fernandez R., Falkow S., Schoolnik G.K. J. Exp. Med. 168:983-1002(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Fimbrium

Protein Families: N-Me-Phe pilin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20657

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose