Recombinant Momordica charantia Ribonuclease MC | CSB-EP340549MHQ

(No reviews yet) Write a Review
SKU:
CSB-EP340549MHQ
Availability:
3 - 7 Working Days
$422.40 - $2,042.40

Description

Recombinant Momordica charantia Ribonuclease MC | CSB-EP340549MHQ | Cusabio

Alternative Name(s): RNase MC

Gene Names: N/A

Research Areas: Others

Organism: Momordica charantia(Bitter gourd)(Balsam pear)

AA Sequence: FDSFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQGSGTSLTNCPQGSPFDITKISHLQSQLNTLWPNVLRANNQQFWSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPHAAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVSYLVQVVACFAQDGSTLIDCTRDTCGANFIF

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-191aa

Sequence Info: Full Length

MW: 28.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: RNA + H(2)O = an (RNA fragment)-3'-nucleoside-3'-phosphate + a 5'-hydroxy-ribonucleotide-3'-(RNA fragment).

Reference: "Crystal structure of a ribonuclease from the seeds of bitter gourd (Momordica charantia) at 1.75 A resolution." Nakagawa A., Tanaka I., Sakai R., Nakashima T., Funatsu G., Kimura M. Biochim. Biophys. Acta 1433:253-260(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P23540

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose