Recombinant Methanothermus fervidus DNA-binding protein HMf-2 (hmfB) | CSB-EP322515MFF

(No reviews yet) Write a Review
SKU:
CSB-EP322515MFF
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Methanothermus fervidus DNA-binding protein HMf-2 (hmfB) | CSB-EP322515MFF | Cusabio

Alternative Name(s): Archaeal histone B

Gene Names: hmfB

Research Areas: Cancer

Organism: Methanothermus fervidus

AA Sequence: MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-69aa

Sequence Info: Full Length

MW: 11.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds and compacts DNA (95 to 150 base pairs) to form nucleosome-like structures that contain positive DNA supercoils (PubMed:2377617, PubMed:7809089, PubMed:10704305, PubMed:28798133). Increases the resistance of DNA to thermal denaturation in vitro (PubMed:2377617).

Reference: "HMf, a DNA-binding protein isolated from the hyperthermophilic archaeon Methanothermus fervidus, is most closely related to histones." Sandman K.M., Krzycki J.A., Dobrinski B., Lurz R., Reeve J.N. Proc. Natl. Acad. Sci. U.S.A. 87:5788-5791(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19267

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose