Recombinant Methanothermus fervidus DNA-binding protein HMf-1 (hmfA) | CSB-EP343755MFF

(No reviews yet) Write a Review
SKU:
CSB-EP343755MFF
Availability:
3 - 7 Working Days
€352.00 - €1,702.00

Description

Recombinant Methanothermus fervidus DNA-binding protein HMf-1 (hmfA) | CSB-EP343755MFF | Cusabio

Alternative Name(s): Archaeal histone A

Gene Names: hmfA

Research Areas: Others

Organism: Methanothermus fervidus

AA Sequence: MGELPIAPIGRIIKNAGAERVSDDARIALAKVLEEMGEEIASEAVKLAKHAGRKTIKAEDIELARKMFK

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-69aa

Sequence Info: Full Length

MW: 14.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Binds and compacts DNA (95 to 150 base pairs) to form nucleosome-like structures that contain positive DNA supercoils. Increases the resistance of DNA to thermal denaturation.

Reference: "HMt, a histone-related protein from Methanobacterium thermoautotrophicum delta H." Tabassum R., Sandman K.M., Reeve J.N. J. Bacteriol. 174:7890-7895(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P48781

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose