Recombinant Mesocricetus auratus Placenta-expressed transcript 1 protein (PLET1) | CSB-MP719641MRG

(No reviews yet) Write a Review
SKU:
CSB-MP719641MRG
Availability:
18 - 28 Working Days
  • Recombinant Mesocricetus auratus Placenta-expressed transcript 1 protein (PLET1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£423.20 - £4,116.00

Description

Recombinant Mesocricetus auratus Placenta-expressed transcript 1 protein (PLET1) | CSB-MP719641MRG | Cusabio

Alternative Name(s): Antigen AgK114

Gene Names: PLET1

Research Areas: Cell Biology

Organism: Mesocricetus auratus (Golden hamster)

AA Sequence: ASYNDPCTVFDTISTTNLRVNITAEGSGENITYTVWVHVNSSVSVVILKAVNQDNKPVGTWVGATQECNDSSVLYRVTPSDNSDFQATWIVPNSEDITKVNLHVLMAIGNGTAAVTSVNLGEPQTSTPLRPTPEISETNQTTTMTTDKTPAMTTAKTPAMTTAKTTAKTTAKTTVKTTAMTTAKTTAKSLAVNALGS

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 27-223aa

Sequence Info: Full Length of Mature Protein

MW: 25.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle (By similarity).

Reference: "Identification of the novel membrane-associated protein AgK114 on hamster keratinocytes recognized by a monoclonal antibody K114." Tatefuji T., Arai C., Okura T., Kayano T., Mori T., Takakura-Yamamoto R., Takeuchi M., Ohta T., Kurimoto M. Biol. Pharm. Bull. 27:1742-1749(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5W9T8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose