Recombinant Macaca mulatta Growth hormone receptor (GHR), partial | CSB-EP009411MOW

(No reviews yet) Write a Review
SKU:
CSB-EP009411MOW
Availability:
3 - 7 Working Days
  • Recombinant Macaca mulatta Growth hormone receptor (GHR), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Macaca mulatta Growth hormone receptor (GHR), partial | CSB-EP009411MOW | Cusabio

Alternative Name(s): Somatotropin receptor

Gene Names: GHR

Research Areas: Cell Biology

Organism: Macaca mulatta (Rhesus macaque)

AA Sequence: FSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTSVWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPNADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNYGEFSEVLYVTLPQMNQFTCEEDFY

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 19-264aa

Sequence Info: Partial

MW: 30.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.

Reference: "Monkey growth hormone (GH) receptor gene expression. Evidence for two mechanisms for the generation of the GH binding protein." Martini J.-F., Pezet A., Guezennec C.Y., Edery M., Postel-Vinay M.-C., Kelly P.A. J. Biol. Chem. 272:18951-18958(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway (By similarity).

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein, Note=On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway, SUBCELLULAR LOCATION: Growth hormone-binding protein: Secreted

Protein Families: Type I cytokine receptor family, Type 1 subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P79194

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose