Recombinant Macaca mulatta Chemokine CCL20/MIP-3ALPHA (CCL20) | CSB-EP004784MOW

(No reviews yet) Write a Review
SKU:
CSB-EP004784MOW
Availability:
13 - 23 Working Days
  • Recombinant Macaca mulatta Chemokine CCL20/MIP-3ALPHA (CCL20)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Macaca mulatta Chemokine CCL20/MIP-3ALPHA (CCL20) | CSB-EP004784MOW | Cusabio

Alternative Name(s): /

Gene Names: CCL20

Research Areas: Others

Organism: Macaca mulatta (Rhesus macaque)

AA Sequence: ASNFDCCLRYTDRILHPKFIVGFTQQLANETCDINAVVFHTKKGLSVCANPKQTWVKLIVRRLSKKINKM

Source: E.coli

Tag Info: N-terminal 10xHis-GST-tagged

Expression Region: 27-96aa

Sequence Info: Full Length of Mature Protein

MW: 36.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Molecular cloning and sequencing of 25 different rhesus macaque chemokine cDNAs reveals evolutionary conservation among C, CC, CXC, and CX3C families of chemokines."Basu S., Schaefer T.M., Ghosh M., Fuller C.L., Reinhart T.A.Cytokine 18:140-148(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8HYP6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose