Cusabio Macaca mulatta Recombinants
Recombinant Macaca mulatta C-X-C motif chemokine 10 (CXCL10) | CSB-EP822646MOW
- SKU:
- CSB-EP822646MOW
- Availability:
- 13 - 23 Working Days
Description
Recombinant Macaca mulatta C-X-C motif chemokine 10 (CXCL10) | CSB-EP822646MOW | Cusabio
Alternative Name(s): 10KDA interferon gamma-induced protein ;Gamma-IP10 ;IP-10Small-inducible cytokine B10
Gene Names: CXCL10
Research Areas: Others
Organism: Macaca mulatta (Rhesus macaque)
AA Sequence: IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 22-98aa
Sequence Info: Full Length of Mature Protein
MW: 12.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Chotactic for monocytes and T-lymphocytes. Binds to CXCR3 .
Reference: Increased expression of the interferon-gamma-inducible chemokine Mig/CXCL9 in lymphoid tissues during simian immunodeficiency virus infection in vivo.Reinhart T.A., Fallert B.A., Pfeifer M., Capuano S. III, Rajakumar P., Murphey-Corb M., Day R., Fuller C.L., Schaefer T.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3 (By similarity).
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Intercrine alpha (chemokine CxC) family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q8MIZ1
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A