Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain (CD3G), partial | CSB-YP850179MOV

(No reviews yet) Write a Review
SKU:
CSB-YP850179MOV
Availability:
3 - 7 Working Days
  • Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain (CD3G), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £508.80

Description

Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain (CD3G), partial | CSB-YP850179MOV | Cusabio

Alternative Name(s): T-cell receptor T3 gamma chain CD_antigen: CD3g

Gene Names: CD3G

Research Areas: Immunology

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence: QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 23-113aa

Sequence Info: Extracellular Domain

MW: 12.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The CD3 complex mediates signal transduction.

Reference: "CD3 polymorphism in cynomolgus monkeys (Macaca fascicularis)."Uda A., Tanabayashi K., Mukai R., Yachi M., Nam K., Yamada A.J. Med. Primatol. 30:141-147(2001) .

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q95LI7

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose