Recombinant Macaca fascicularis Interleukin-4 (IL4) | CSB-EP301281MOV

(No reviews yet) Write a Review
SKU:
CSB-EP301281MOV
Availability:
13 - 23 Working Days
  • Recombinant Macaca fascicularis Interleukin-4 (IL4)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£238.40 - £1,361.60

Description

Recombinant Macaca fascicularis Interleukin-4 (IL4) | CSB-EP301281MOV | Cusabio

Alternative Name(s): B-cell stimulatory factor 1 (BSF-1) (Lymphocyte stimulatory factor 1)

Gene Names: IL4

Research Areas: Immunology

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence: HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-153aa

Sequence Info: Full Length of Mature Protein

MW: 18.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Reference: "Cloning of interleukin-4 delta2 splice variant (IL-4delta2) in chimpanzee and cynomolgus macaque: phylogenetic analysis of delta2 splice variant appearance, and implications for the study of IL-4-driven immune processes."Gautherot I., Burdin N., Seguin D., Aujame L., Sodoyer R.Immunogenetics 54:635-644(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Positively regulates IL31RA expression in macrophages.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-4/IL-13 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P79339

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose