Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial | CSB-CF357830LKW(A4)

(No reviews yet) Write a Review
SKU:
CSB-CF357830LKW(A4)
Availability:
3 - 7 Working Days
  • Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$772.80 - $1,082.40

Description

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial | CSB-CF357830LKW(A4) | Cusabio

Alternative Name(s): GPC; GP-C; Segment; SPre-glycoprotein polyprotein GP complex; Pre-GP-C) [Cleaved into: Stable signal peptide; SSP); Glycoprotein G1; GP1); Glycoprotein G2; GP2)]

Gene Names: GPC

Research Areas: Others

Organism: Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV)

AA Sequence: ALPHIIDEVINIVIIVLIVITGIKAVYNFATCGIFALISFLLLAGRSCGMYGLKGPDIYKGVYQFKSVEFDMSHLNLTMPN

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 10-90aa

Sequence Info: Partial

MW: 24.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.1 Publication Glycoprotein G1 mediates virus attachment to host receptor alpha-dystroglycan DAG1. This attachment induces virion internalization predominantly through clathrin- and caveolin-independent endocytosis.1 Publication Glycoprotein G2 is a class I viral fusion protein, that directs fusion of viral and host endosomal membranes, leading to delivery of the nucleocapsid into the cytoplasm. Membrane fusion is mediated by irreversable conformational changes induced upon acidification in the endosome.

Reference: "Mutagenesis-induced, large fitness variations with an invariant arenavirus consensus genomic nucleotide sequence."Grande-Perez A., Gomez-Mariano G., Lowenstein P.R., Domingo E.J. Virol. 79:10451-10459(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Stable signal peptide is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion.

Involvement in disease:

Subcellular Location: Stable signal peptide: Virion membrane, Multi-pass membrane protein, Host cell membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: Glycoprotein G1: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, SUBCELLULAR LOCATION: Glycoprotein G2: Virion membrane, Single-pass membrane protein, Host cell membrane, Single-pass membrane protein

Protein Families: Arenaviridae GPC protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09991

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose