Cusabio Virus & Bacteria Recombinants
Recombinant Lithobates catesbeiana Saxiphilin, partial | CSB-BP339158LQA(A5)
- SKU:
- CSB-BP339158LQA(A5)
- Availability:
- 28 - 38 Working Days
Description
Recombinant Lithobates catesbeiana Saxiphilin, partial | CSB-BP339158LQA(A5) | Cusabio
Alternative Name(s): Short name: SAX
Gene Names: N/A
Research Areas: Others
Organism: Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)
AA Sequence: AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC
Source: Baculovirus
Tag Info: C-terminal 9xHis-tagged
Expression Region: 484-844aa
Sequence Info: Partial
MW: 41.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Reference: "Molecular cloning of bullfrog saxiphilin: a unique relative of the transferrin family that binds saxitoxin."Morabito M.A., Moczydlowski E.Proc. Natl. Acad. Sci. U.S.A. 91:2478-2482(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Transferrin family
Tissue Specificity: Plasma. Highest levels of transcripts found in the liver, the lung, the pancreas and the brain.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P31226
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A