Recombinant Leuconostoc mesenteroides subsp. Cremoris D-lactate dehydrogenase | CSB-RP186974Ba

Recombinant Leuconostoc mesenteroides subsp. Cremoris D-lactate dehydrogenase | CSB-RP186974Ba | Cusabio

Alternative Name(s): D-lactate dehydrogenase; D-LDH; EC 1.1.1.28; D-specific 2-hydroxyacid dehydrogenase

Gene Names: N/A

Research Areas: Others

Organism: Leuconostoc mesenteroides subsp. cremoris

AA Sequence: MKIFAYGIRDDEKPSLEEWKAANPEIEVDYTQELLTPETAKLAEGSDSAVVYQQLDYTRETLTALANVGVTNLSLRNVGTDNIDFDAAREFNFNISNVPVYSPNAIAEHSMLQLSRLLRRTKALDAKIAKRDLRWAPTTGREMRMQTVGVIGTGHIGRVAINILKGFGAKVIAYDKYPNAELQAEGLYVDTLDELYAQADAISLYVPGVPENHHLINADAIAKMKDGVVIMNAARGNLMDIDAIIDGLNSGKISDFGMDVYENEVACSMKIGLVKNSPDAKIADLIARENVMITPHTAFYTTKAVLEMVHQSFDAAVAFAKGEKPAIAVEY

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-331aa

Sequence Info: Full Length

MW: 40.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Purification, properties and DNA sequence of the D-lactate dehydrogenase from Leuconostoc mesenteroides subsp. cremoris.Dartois V., Phalip V., Schmitt P., Divies C.Res. Microbiol. 146:291-302(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: D-isomer specific 2-hydroxyacid dehydrogenase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P51011

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A