Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT | CSB-EP322958LDS

(No reviews yet) Write a Review
SKU:
CSB-EP322958LDS
Availability:
3 - 7 Working Days
  • Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT | CSB-EP322958LDS | Cusabio

Alternative Name(s): Lqh-alpha-IT Short name: Alpha-IT

Gene Names: N/A

Research Areas: Others

Organism: Leiurus quinquestriatus hebraeus (Yellow scorpion)

AA Sequence: VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-85aa

Sequence Info: Full Length of Mature Protein

MW: 23.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.

Reference: "Nucleotide sequence and structure analysis of a cDNA encoding an alpha insect toxin from the scorpion Leiurus quinquestriatus hebraeus." Gurevitz M., Urbach D., Zlotkin E., Zilberberg N.Toxicon 29:1270-1272(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17728

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose