Recombinant Leiurus hebraeus Alpha-like toxin Lqh6 | CSB-BP348580LDS

(No reviews yet) Write a Review
SKU:
CSB-BP348580LDS
Availability:
28 - 38 Working Days
£354.40 - £1,177.60

Description

Recombinant Leiurus hebraeus Alpha-like toxin Lqh6 | CSB-BP348580LDS | Cusabio

Alternative Name(s): Lqh VI (LqhVI)

Gene Names: N/A

Research Areas: Others

Organism: Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

AA Sequence: VRDGYIAQPENCVYHCIPDCDTLCKDNGGTGGHCGFKLGHGIACWCNALPDNVGIIVDGVKCHK

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-64aa

Sequence Info: Full Length

MW: 10.7

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is highly toxic to insects and mice, and inhibits the binding of alpha-toxin to cockroach neuronal membranes.

Reference: "Characterization of scorpion alpha-like toxin group using two new toxins from the scorpion Leiurus quinquestriatus hebraeus." Hamon A., Gilles N., Sautiere P., Martinage A., Kopeyan C., Ulens C., Tytgat J., Lancelin J.-M., Gordon D. Eur. J. Biochem. 269:3920-3933(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P59356

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose