Recombinant Lecanicillium psalliotae Alkaline serine protease ver112 | CSB-EP737896LCAT

Recombinant Lecanicillium psalliotae Alkaline serine protease ver112 | CSB-EP737896LCAT | Cusabio

Alternative Name(s): Alkaline serine protease ver112; EC 3.4.21.-

Gene Names: N/A

Research Areas: Others

Organism: Lecanicillium psalliotae (Verticillium psalliotae)

AA Sequence: AITQQQGATWGLTRISHRARGSTAYAYDTSAGAGACVYVIDTGVEDTHPDFEGRAKQIKSYASTARDGHGHGTHCAGTIGSKTWGVAKKVSIFGVKVLDDSGSGSLSNIVAGMDFVASDRQSRNCPRRTVASMSLGGGYSAALNQAAARLQSSGVFVAVAAGNDNRDAANTSPASEPTVCTVGATDSNDVRSTFSNYGRVVDIFAPGTSITSTWIGGRTNTISGTSMATPHIAGLAAYLFGLEGGSAGAMCGRIQTLSTKNVLTSIPSGTVNYLAFNGAT

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 103-382aa

Sequence Info: Full Length of Mature Protein

MW: 36.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Serine protease which can degrade the nematode cuticle.

Reference: "The crystal structures of two cuticle-degrading proteases from nematophagous fungi and their contribution to infection against nematodes." Liang L., Meng Z., Ye F., Yang J., Liu S., Sun Y., Guo Y., Mi Q., Huang X., Zou C., Rao Z., Lou Z., Zhang K.Q. FASEB J. 24:1391-1400(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Serine protease which can degrade the nematode cuticle.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase S8 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q68GV9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A