Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase (pyrE) | CSB-EP506933LNO

Recombinant Laribacter hongkongensis Orotate phosphoribosyltransferase (pyrE) | CSB-EP506933LNO | Cusabio

Alternative Name(s): Short name:OPRT Short name:OPRTase

Gene Names: pyrE

Research Areas: Others

Organism: Laribacter hongkongensis (strain HLHK9)

AA Sequence: MSDFRQDFIRFAVEEQVLRFGEFVTKAGRPSPYFFNAGLFNHGASLLSLARFYARSISESGIAFDMLFGPAYKGIVLAGATAMMLAEQGRDVPFAFNRKEAKDHGEGGTLIGAPLKGRVLIIDDVISAGTSVRESVEIIRANGAEPAGVAIALDRMERGQGELSATQEVAQKFGLPVVAIASLDDLLGFLAGSPDLADNLTRVEAYRTQYGVR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-213aa

Sequence Info: Full Length

MW: 38.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).

Reference: "The complete genome and proteome of Laribacter hongkongensis reveal potential mechanisms for adaptations to different temperatures and habitats."Woo P.C.Y., Lau S.K.P., Tse H., Teng J.L.L., Curreem S.O., Tsang A.K.L., Fan R.Y.Y., Wong G.K.M., Huang Y., Loman N.J., Snyder L.A.S., Cai J.J., Huang J.-D., Mak W., Pallen M.J., Lok S., Yuen K.-Y.PLoS Genet. 5:E1000416-E1000416(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).

Involvement in disease:

Subcellular Location:

Protein Families: Purine/pyrimidine phosphoribosyltransferase family, PyrE subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: C1D6F5

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A