null

Recombinant Lactococcus lactis subsp. lactis Prolipoprotein diacylglyceryl transferase (lgt), Nanodisc | CSB-CF875009LNG-N

(No reviews yet) Write a Review
SKU:
CSB-CF875009LNG-N
Availability:
18 - 23 Working Days
  • Recombinant Lactococcus lactis subsp. lactis Prolipoprotein diacylglyceryl transferase (lgt), Nanodisc
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€1,387.00 - €2,260.00
Frequently bought together:

Description

Recombinant Lactococcus lactis subsp. lactis Prolipoprotein diacylglyceryl transferase (lgt), Nanodisc | CSB-CF875009LNG-N | Cusabio

Alternative Name(s): /

Gene Names: lgt

Research Areas: Others

Organism: Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)

AA Sequence: MNNLFPFLALNKIALQLGPLAIHWYAIFIVGGAALAVWLACKEAPKRNIKTDDIIDFVLFAFPLGIVGARLYYVIFQWSYYSQHPSQIIAMWDGGGAIYGSLIAGAIVLFVFSYYRMIHPLDLLDITIPGVFLAQAMGRWGNFVNQEAYGKIVSNLDWLPAFIRNQMFIDGHYRMPTFLFESIGTLSGFILVMVFRHRIKGLKRGDIFSFYLVWYGAVRFIVEGMRTDSLMLGPARVSQWLSVLLVIVGLVLFIYRRMKKN

Source: in vitro E.coli expression system

Tag Info: C-terminal 6xHis-tagged

Expression Region: 1-261aa

Sequence Info: Full Length

MW: 32.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Transfers the N-acyl diglyceride group on what will become the N-terminal cysteine of membrane lipoproteins.

Reference: "The complete genome sequence of the lactic acid bacterium Lactococcus lactis ssp. lactis IL1403." Bolotin A., Wincker P., Mauger S., Jaillon O., Malarme K., Weissenbach J., Ehrlich S.D., Sorokin A. Genome Res. 11:731-753(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9CHU9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose