Recombinant Lactobacillus plantarum L-lactate dehydrogenase 1 (ldh1) | CSB-EP348716LMS

Recombinant Lactobacillus plantarum L-lactate dehydrogenase 1 (ldh1) | CSB-EP348716LMS | Cusabio

Alternative Name(s): ldh1; l-ldhL; ldh; ldhL; ldhL1; lp_0537L-lactate dehydrogenase 1; L-LDH 1; EC 1.1.1.27

Gene Names: ldh1

Research Areas: Others

Organism: Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)

AA Sequence: MSSMPNHQKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRLRVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTRPVRDVAKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAVIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELENK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-320aa

Sequence Info: Full Length

MW: 61.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Expression of Derf 7 gene in Lactobacillus plantarum.Kim J., Tsutsui M., Yamashita M., Murooka Y. Complete genome sequence of Lactobacillus plantarum WCFS1.Kleerebezem M., Boekhorst J., van Kranenburg R., Molenaar D., Kuipers O.P., Leer R., Tarchini R., Peters S.A., Sandbrink H.M., Fiers M.W.E.J., Stiekema W., Klein Lankhorst R.M., Bron P.A., Hoffer S.M., Nierop Groot M.N., Kerkhoven R., De Vries M., Ursing B., De Vos W.M., Siezen R.J.Proc. Natl. Acad. Sci. U.S.A. 100:1990-1995(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: LDH/MDH superfamily, LDH family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P56512

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A