Recombinant Influenza B virus Non-structural protein 1 (NS) | CSB-YP319433IJU

(No reviews yet) Write a Review
SKU:
CSB-YP319433IJU
Availability:
25 - 35 Working Days
  • Recombinant Influenza B virus Non-structural protein 1 (NS)
  • The reducing (R) protein migrates as 65 kDa in SDS-PAGE may be due to glycosylation.
$406.80 - $1,614.00

Description

Recombinant Influenza B virus Non-structural protein 1 (NS) | CSB-YP319433IJU | Cusabio

Alternative Name(s): NS1A

Gene Names: NS

Research Areas: Microbiology

Organism: Influenza B virus (strain B/Singapore/222/1979)

AA Sequence: MAENMTTTQIEVGPGATNATINFEAGILECYERLSWQRALDYPGQDRLNRLKRKLESRIKTHNKSEPESKRMSLEERKAIGVKMMKVLLFMNPSAGIEGFEPYCMKNFSNSNCPNYNWTDYPPTPGKCLDDIEEEPENVDDPTEIVLRDMNNKDARQKIKEEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGKFLKHPNGYKTLSTLHRLNVYDQSGRLVAKLVATDDLTVEDEEDGHRILNSLFERFNEGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-281aa

Sequence Info: Full Length

MW: 34.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Binds and inhibits the conjugation of the ubiquitin-like G1P2/ISG15 protein to its target proteins. Since G1P2/ISG15 is an early antiviral protein, NS1 may inhibit the host antiviral response. Prevents EIF2AK2/PKR activation, either by binding double strand RNA or by interacting directly with EIF2AK2/PKR. Also binds poly(A) and U6 snRNA.

Reference: "Influenza B virus evolution: co-circulating lineages and comparison of evolutionary pattern with those of influenza A and C viruses." Yamashita M., Krystal M., Fitch W.M., Palese P. Virology 163:112-122(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds and inhibits the conjugation of the ubiquitin-like G1P2/ISG15 protein to its target proteins. Since G1P2/ISG15 is an early antiviral protein, NS1 may inhibit the host antiviral response. Prevents EIF2AK2/PKR activation, either by binding double strand RNA or by interacting directly with EIF2AK2/PKR. Also binds poly(A) and U6 snRNA.

Involvement in disease:

Subcellular Location: Host cytoplasm, Host nucleus

Protein Families: Influenza B viruses NS1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12600

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose