Recombinant Human Zinc finger protein 91 (ZNF91), partial | CSB-RP020054h

Recombinant Human Zinc finger protein 91 (ZNF91), partial | CSB-RP020054h | Cusabio

Alternative Name(s): Membrane-bound C2 domain-containing protein

Gene Names: ZNF91

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MPGTPGSLEMGLLTFRDVAIEFSPEEWQCLDTAQQNLYRNVMLENYRNLAFLGIALSKPDLITYLEQGKEPWNMKQHEMVDEPTGICPHFPQDFWPEQSMEDSFQKVLLRKYEKCGHENLQLRKGCKSVDECKVHKEGYNKLNQCLTTAQSKVFQCGKYLKVFYKFLNSNRHTIRHTGKKCFKCKKCVKSFCIRLHKTQHKCVYITEK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-208aa

Sequence Info: Partial

MW: 51.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell mbrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell mbrane and promotes the formation of appositions between the endoplasmic reticulum and the cell mbrane.

Reference: E-Syts, a family of membranous Ca2+-sensor proteins with multiple C2 domains.Min S.-W., Chang W.-P., Suedhof T.C.Proc. Natl. Acad. Sci. U.S.A. 104:3823-3828(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transcription factor specifically required to repress SINE-VNTR-Alu (SVA) retrotransposons

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Krueppel C2H2-type zinc-finger protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q05481

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM